CRYBA4 Antibody - #DF14158
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Beta A4 crystallin; Beta crystallin A4; Beta-A4 crystallin; Beta-crystallin A4; CRBA4_HUMAN; CRYBA4; Crystallin beta A4; Crystallin, beta polypeptide A4; CTRCT23; Eye lens structural protein; MCOPCT4;
Immunogens
A synthesized peptide derived from Human CRYBA4.
- P53673 CRBA4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLQCTKSAGPWKMVVWDEDGFQGRRHEFTAECPSVLELGFETVRSLKVLSGAWVGFEHAGFQGQQYILERGEYPSWDAWGGNTAYPAERLTSFRPAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQQ
Research Backgrounds
Crystallins are the dominant structural components of the vertebrate eye lens.
Homo/heterodimer, or complexes of higher-order. The structure of beta-crystallin oligomers seems to be stabilized through interactions between the N-terminal arms (By similarity).
Has a two-domain beta-structure, folded into four very similar Greek key motifs.
Belongs to the beta/gamma-crystallin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.