HELT Antibody - #DF14188
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Hairy and enhancer of split-related protein HELT; HCM1228; HELT; HELT_HUMAN; HES like; HES/HEY like transcription factor; HES/HEY-like transcription factor; HESL; Heslike; Hey like transcription factor; Hey like transcription factor (zebrafish); Hey like transcriptional repressor; Megane bHLH factor; Mgn;
Immunogens
A synthesized peptide derived from Human HELT.
- A6NFD8 HELT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
Research Backgrounds
Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.
Nucleus.
Self-associates. Interacts with HES5 and HEY2 (By similarity).
Belongs to the HEY family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.