RHOJ Antibody - #DF14204
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ARHJ; Ras homolog family member J; Ras homolog gene family member J; RAS like family 7 member B; Ras like protein family member 7B; Ras-like protein family member 7B; RASL 7B; RASL7B; Rho related GTP binding protein RhoJ; Rho-related GTP-binding protein RhoJ; RHOI; Rhoj; RHOJ_HUMAN; Tc10 like GTP binding protein TCL; TC10 like Rho GTPase; Tc10-like GTP-binding protein; TC10B; TCL;
Immunogens
A synthesized peptide derived from Human RHOJ.
Specifically expressed in endothelial cells in different tissues, such as brain, heart, lung and liver.
- Q9H4E5 RHOJ_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII
Research Backgrounds
Plasma membrane-associated small GTPase specifically involved in angiogenesis. Required for endothelial cell migration during vascular development via its interaction with GLUL. Elicits the formation of F-actin-rich structures, thereby regulating endothelial cell migration.
Palmitoylated; regulates localization to the plasma membrane and may be mediated by GLUL.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Note: Localization to the plasma membrane is regulated by GLUL.
Specifically expressed in endothelial cells in different tissues, such as brain, heart, lung and liver.
Belongs to the small GTPase superfamily. Rho family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.