Melanoma Inhibitory Activity Antibody - #DF14235
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cartilage derived retinoic acid sensitive protein; CD RAP; CDRAP; Melanoma derived growth regulatory protein precursor; Melanoma inhibitory activity protein; Melanoma-derived growth regulatory protein; Mia; MIA_HUMAN;
Immunogens
A synthesized peptide derived from Human Melanoma Inhibitory Activity.
- Q16674 MIA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Research Backgrounds
Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.
May possess two intramolecular disulfide bonds.
Secreted.
All malignant melanoma cell lines tested and infrequently in glioma cell lines.
Interacts with FASLG. Interacts with TMIGD2.
Belongs to the MIA/OTOR family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.