PEBP4 Antibody - #DF14324
Product: | PEBP4 Antibody |
Catalog: | DF14324 |
Description: | Rabbit polyclonal antibody to PEBP4 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 26kD(Calculated). |
Uniprot: | Q96S96 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1700051A02Rik; 1700081D17Rik; AI429082; CORK 1; CORK1; Cousin of RKIP 1 protein; GWTM1933; hPEBP4; MGC22776; PEBP 4; Phosphatidylethanolamine binding protein 4; PRO4408; Protein cousin of RKIP 1; UNQ1933/PRO4408;
Immunogens
A synthesized peptide derived from Human PEBP4.
- Q96S96 PEBP4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHKNQAEIAAC
Research Backgrounds
Seems to promote cellular resistance to TNF-induced apoptosis by inhibiting activation of the Raf-1/MEK/ERK pathway, JNK and phosphatidylethanolamine externalization.
Lysosome.
Ubiquitously expressed. Highly expressed in tumor cells.
Belongs to the phosphatidylethanolamine-binding protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.