Product: PRMT2 Antibody
Catalog: DF14342
Description: Rabbit polyclonal antibody to PRMT2
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 49kD(Calculated).
Uniprot: P55345

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PRMT2 Antibody detects endogenous levels of total PRMT2.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ANM2_HUMAN; EC 2.1.1.; histone arginine N methyltransferase PRMT2; Histone-arginine N-methyltransferase PRMT2; HMT 1; HMT1 (hnRNP methyltransferase S. cerevisiae) like 1; HMT1; HMT1 hnRNP methyltransferase like 1; hnRNP methyltransferase (S. cerevisiae) like 1; hnRNP methyltransferase like 1; Hrmt1l1; MGC111373; PRMT 2; PRMT2 alpha; prmt2; PRMT2 beta; PRMT2 gamma; PRMT2 protein; PRMT2L2; Protein arginine methyltransferase 2; Protein arginine N methyltransferase 2; Protein arginine N-methyltransferase 2; Zf2;

Immunogens

Immunogen:

A synthesized peptide derived from Human PRMT2.

Uniprot:
Gene(ID):
Expression:
P55345 ANM2_HUMAN:

Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.

Sequence:
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

Research Backgrounds

Function:

Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.

Subcellular Location:

Cytoplasm. Nucleus.
Note: Translocates from the cytoplasm to the nucleus, after hormone exposure. Excluded from nucleolus.

Nucleus.
Note: Excluded from nucleolus.

Cytoplasm. Nucleus. Nucleus>Nucleolus.

Nucleus.
Note: Excluded from nucleolus.

Cytoplasm. Nucleus.
Note: Predominantly cytoplasmic.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.

Family&Domains:

Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.