PRMT2 Antibody - #DF14342
| Product: | PRMT2 Antibody |
| Catalog: | DF14342 |
| Description: | Rabbit polyclonal antibody to PRMT2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 49kD(Calculated). |
| Uniprot: | P55345 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ANM2_HUMAN; EC 2.1.1.; histone arginine N methyltransferase PRMT2; Histone-arginine N-methyltransferase PRMT2; HMT 1; HMT1 (hnRNP methyltransferase S. cerevisiae) like 1; HMT1; HMT1 hnRNP methyltransferase like 1; hnRNP methyltransferase (S. cerevisiae) like 1; hnRNP methyltransferase like 1; Hrmt1l1; MGC111373; PRMT 2; PRMT2 alpha; prmt2; PRMT2 beta; PRMT2 gamma; PRMT2 protein; PRMT2L2; Protein arginine methyltransferase 2; Protein arginine N methyltransferase 2; Protein arginine N-methyltransferase 2; Zf2;
Immunogens
A synthesized peptide derived from Human PRMT2.
Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.
- P55345 ANM2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
Research Backgrounds
Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.
Cytoplasm. Nucleus.
Note: Translocates from the cytoplasm to the nucleus, after hormone exposure. Excluded from nucleolus.
Nucleus.
Note: Excluded from nucleolus.
Cytoplasm. Nucleus. Nucleus>Nucleolus.
Nucleus.
Note: Excluded from nucleolus.
Cytoplasm. Nucleus.
Note: Predominantly cytoplasmic.
Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.
Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.