P311 Antibody - #DF14359
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
3.1 gene; C5orf13; Chromosome 5 open reading frame 13; D4S114; Neuronal protein 3.1; Neuronal regeneration related protein; Neuronal regeneration related protein homolog (rat); Neuronal regeneration related protein homolog; NP311_HUMAN; NREP; P311; PRO1873; Protein p311; PTZ17; SEZ17;
Immunogens
A synthesized peptide derived from Human P311.
- Q16612 NREP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
Research Backgrounds
May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.
Phosphorylated on Ser-59. Phosphorylation decreases stability and activity.
Cytoplasm.
Expressed in lung (at protein level).
Interacts with the latency-associated peptides (LAP) of TGFB1 and TGFB2; the interaction results in a decrease in TGFB autoinduction (By similarity). Interacts with FLNA.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.