Product: P311 Antibody
Catalog: DF14359
Description: Rabbit polyclonal antibody to P311
Application: IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 8kD(Calculated).
Uniprot: Q16612

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
P311 Antibody detects endogenous levels of total P311.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

3.1 gene; C5orf13; Chromosome 5 open reading frame 13; D4S114; Neuronal protein 3.1; Neuronal regeneration related protein; Neuronal regeneration related protein homolog (rat); Neuronal regeneration related protein homolog; NP311_HUMAN; NREP; P311; PRO1873; Protein p311; PTZ17; SEZ17;

Immunogens

Immunogen:

A synthesized peptide derived from Human P311.

Uniprot:
Gene(ID):
Expression:
Q16612 NREP_HUMAN:

Expressed in lung (at protein level).

Sequence:
MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF

Research Backgrounds

Function:

May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.

PTMs:

Phosphorylated on Ser-59. Phosphorylation decreases stability and activity.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in lung (at protein level).

References

1). NREP, transcriptionally upregulated by HIF-1α, aggravates breast cancer cell growth and metastasis by promoting glycolysis. Cell death discovery, 2024 (PubMed: 38697993) [IF=7.0]

Application: IHC    Species: human    Sample:

Fig. 1: NREP is upregulated and predicts poor prognosis value in BC patients. A Venn diagram of 22 upregulated differentially expressed genes (DEGs) in nine BC databases from GEO. B Heat map of 22 DEGs in nine BC databases. C Kyoto Encyclopedia of Genes and Genomes (KEGG) enrichment analysis of 22 DEGs was analyzed by DAVIVD. D Gene ontology (GO) enrichment analysis of 22 DEGs was analyzed by DAVIVD. BP biological process, CC cellular component, MF molecular function. E The mRNA expression level of NREP in nine BC databases. T: tumor tissues; C: normal tissues. F The expression of NREP in the tumor, para-carcinoma, and healthy tissues of BC patients (analyzed by Breast Cancer Gene-Expression Miner v4.9). G Survival curves of BC patients with high or low NREP level (analyzed by Biomedical Informatics Institute). Overall survival (OS), metastasis-free survival (MFS), progression-free interval (PFI), and progression-free survival (PFS). H IHC staining of BC clinical samples with low or high NREP expression. Data were expressed as mean ± SD. *P 

Application: WB    Species: human    Sample: MDA-MB-468 cells

Fig. 2: NREP is transcriptional activated by HIF-1α. A The expression of NREP in hypoxia and normoxia BC cells (data from GSE3188 and GSE111259). B The expression of NREP in HIF-1α depleted BC cells (data from GSE3188). C The mRNA expression of NREP in different BC cell lines (SK-BR-3, MCF-7, MDA-MB-468, MDA-MB-231) at normoxia or hypoxia was measured by qPCR. The mRNA expression of HIF-1α (D) and NREP (E) in HIF-1α inhibited MDA-MB-468 or MDA-MB-231 cells were measured by qPCR. F The protein expression and quantification data of NREP and HIF-1α in MDA-MB-468 or MDA-MB-231 cells were measured by western blot. G, H Luciferase reporter assay was used to confirm the binding sites of HIF-1α on NREP promoter. I, J ChIP-PCR assay was used to confirm that HIF-1α could directly bind with the promoter of NREP. Data were expressed as mean ± SD. *P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.