Product: PSMB10 Antibody
Catalog: DF14390
Description: Rabbit polyclonal antibody to PSMB10
Application: ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 26,29kD; 29kD(Calculated).
Uniprot: P40306

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
PSMB10 Antibody detects endogenous levels of total PSMB10.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

beta2i; FLJ00366; LMP10; Low molecular mass protein 10; Macropain subunit MECl 1; Macropain subunit MECl-1; MECL1; MGC1665; Multicatalytic endopeptidase complex subunit MECl 1; Multicatalytic endopeptidase complex subunit MECl-1; OTTHUMP00000174858; Proteasome (prosome macropain) subunit beta type 10; Proteasome beta 10 subunit; Proteasome catalytic subunit 2i; Proteasome MECl 1; Proteasome MECl-1; Proteasome subunit beta 2i; Proteasome subunit beta 7i; Proteasome subunit beta type 10; Proteasome subunit beta type-10; Proteasome subunit beta-2i; Proteasome subunit MECL1; PSB10_HUMAN; PSMB 10; Psmb10;

Immunogens

Immunogen:

A synthesized peptide derived from Human PSMB10.

Uniprot:
Gene(ID):
Sequence:
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Research Backgrounds

Function:

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

PTMs:

Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase T1B family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.