Product: SENP8 Antibody
Catalog: AF0279
Description: Rabbit polyclonal antibody to SENP8
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 27kDa; 24kD(Calculated).
Uniprot: Q96LD8
RRID: AB_2833448

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(85%), Bovine(85%), Horse(92%), Sheep(85%), Dog(92%)
Clonality:
Polyclonal
Specificity:
SENP8 Antibody detects endogenous levels of total SENP8.
RRID:
AB_2833448
Cite Format: Affinity Biosciences Cat# AF0279, RRID:AB_2833448.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

cysteine 2; DEN 1; DEN1; Deneddylase 1; Deneddylase-1; FKSG8; HsT17512; NEDD 8 specific protease 1; NEDD8 specific protease cysteine 2; NEDD8-specific protease 1; NEDP 1; NEDP1; Protease; Protease, cysteine 2; PRSC2; SENP8; SENP8_HUMAN; Sentrin / SUMO specific protease SENP 8; Sentrin-specific protease 8; Sentrin/SUMO-specific protease SENP8; SUMO sentrin specific protease family member 8; SUMO/sentrin peptidase family member, NEDD8 specific; SUMO/sentrin specific peptidase family member 8;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q96LD8 SENP8_HUMAN:

Broadly expressed, with highest levels in kidney and pancreas.

Description:
SENP8 Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53. Belongs to the peptidase C48 family.
Sequence:
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
92
Dog
92
Pig
85
Bovine
85
Sheep
85
Rabbit
77
Chicken
75
Zebrafish
64
Xenopus
46
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q96LD8 As Substrate

Site PTM Type Enzyme
M1 Acetylation
Y8 Phosphorylation
S11 Phosphorylation
K146 Acetylation

Research Backgrounds

Function:

Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.

Tissue Specificity:

Broadly expressed, with highest levels in kidney and pancreas.

Family&Domains:

Belongs to the peptidase C48 family.

References

1). Sodium valproate attenuates the iE-DAP induced inflammatory response by inhibiting the NOD1-NF-κB pathway and histone modifications in bovine mammary epithelial cells. International Immunopharmacology (PubMed: 32182568) [IF=5.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.