Product: GCSAM Antibody
Catalog: DF14457
Description: Rabbit polyclonal antibody to GCSAM
Application: ELISA(peptide)
Reactivity: Human
Mol.Wt.: 21kD(Calculated).
Uniprot: Q8N6F7

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
GCSAM Antibody detects endogenous levels of GCSAM.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GCAT2; Gcet; GCET2 germinal center expressed transcript 2; GCET2 germinal centre expressed transcript 2; Gcsam; GCSAM_HUMAN; Germinal center associated lymphoma; Germinal center associated lymphoma protein; Germinal center B cell associated protein 2; Germinal center B-cell-expressed transcript 2 protein; Germinal center expressed transcript 2; Germinal center-associated lymphoma protein; Germinal center-associated signaling and motility protein; Germinal centre associated lymphoma; Germinal centre associated lymphoma protein; Germinal centre B cell associated protein 2; Germinal centre expressed transcript 2; hGAL; M17; M17 L;

Immunogens

Immunogen:

A synthesized peptide derived from human GCSAM.

Uniprot:
Gene(ID):
Expression:
Q8N6F7 GCSAM_HUMAN:

Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.

Sequence:
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

Research Backgrounds

Function:

Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.

PTMs:

Phosphorylation on tyrosine residues can be induced by IL6. Phosphorylation is mediated by LYN.

Subcellular Location:

Cytoplasm. Cell membrane.
Note: It relocalizes from the cytoplasm to podosome-like structures upon cell treatment with IL6.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.