Product: CKLF6 Antibody
Catalog: DF14458
Description: Rabbit polyclonal antibody to CKLF6
Application: WB IHC IF/ICC
Reactivity: Mouse, Rat
Mol.Wt.: 20kD(Calculated).
Uniprot: Q9CZ69

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Mouse,Rat
Clonality:
Polyclonal
Specificity:
CKLF6 Antibody detects endogenous levels of CKLF6.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Immunogens

Immunogen:

A synthesized peptide derived from human CKLF6.

Uniprot:
Sequence:
MENGAVYSPTTEAAPGTGRGARSGLAAYFVLGRLPWHRRILKGLQLLLSLLAFICEEVVSECGLCGGLYFFEFVSCSAFLLSLLLLIVYCTPVHDRVDTGKVKSSDFYITLGTGCVFLLASIIFVSTHSGTSAEIAAIVFGFLASSMFLLDFVVMLCEKLRESPLRKPENNAKVEALTEPLNA

Research Backgrounds

Function:

Master regulator of recycling and plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity. Associates with both constitutive and IFNG-induced PD-L1/CD274 at recycling endosomes, where it protects PD-L1/CD274 from being targeted for lysosomal degradation, likely by preventing its ubiquitination. May stabilize PD-L1/CD274 expression on antigen presenting cells and potentiates inhibitory signaling by PDCD1/CD279, its receptor on T-cells, ultimately triggering T-cell anergy.

Subcellular Location:

Cell membrane>Multi-pass membrane protein. Early endosome membrane>Multi-pass membrane protein. Recycling endosome membrane.
Note: Co-localizes with PD-L1/CD274 in the plasma membrane and in recycling endosomes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the chemokine-like factor family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.