TFAP2B Antibody - #DF14476
| Product: | TFAP2B Antibody |
| Catalog: | DF14476 |
| Description: | Rabbit polyclonal antibody to TFAP2B |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 50kD(Calculated). |
| Uniprot: | Q92481 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Activating enhancer binding protein 2 beta; Activating enhancer-binding protein 2-beta; AP 2B; AP2 B; AP2-beta; AP2B; AP2B_HUMAN; AP2beta; MGC21381; OTTHUMP00000039925; PDA2; TFAP 2B; Tfap2b; Transcription factor AP 2 beta; Transcription factor AP-2-beta; Transcription factor AP2 beta;
Immunogens
A synthesized peptide derived from human TFAP2B.
- Q92481 AP2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK
PTMs - Q92481 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S3 | Phosphorylation | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| K21 | Sumoylation | Uniprot | |
| S120 | Phosphorylation | Uniprot | |
| S242 | Phosphorylation | Uniprot | |
| S244 | Phosphorylation | Uniprot | |
| K245 | Ubiquitination | Uniprot | |
| S258 | Phosphorylation | Uniprot | |
| K301 | Ubiquitination | Uniprot | |
| K354 | Ubiquitination | Uniprot |
Research Backgrounds
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-beta appears to be required for normal face and limb development and for proper terminal differentiation and function of renal tubular epithelia.
Sumoylated on Lys-21; which inhibits transcriptional activity.
Nucleus.
Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with CITED4. Interacts with UBE2I. Interacts with KCTD1; this interaction represses transcription activation. Interacts with CITED2 (via C-terminus); the interaction stimulates TFAP2B-transcriptional activity.
Belongs to the AP-2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.