PACRG Antibody - #DF14489
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FLJ32724; GLUP; HAK005771; Molecular chaperone/chaperonin binding protein; Molecular chaperone/chaperonin-binding protein; PACRG; PACRG_HUMAN; PARK 2 co regulated; PARK 2 coregulated; PARK2 co regulated; PARK2 coregulated; PARK2 coregulated gene protein; PARK2CRG; Parkin co regulated gene; Parkin co regulated gene protein; Parkin coregulated gene; Parkin coregulated gene protein; RP3 495O10.2;
Immunogens
A synthesized peptide derived from human PACRG.
Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyte-derived macrophages the primary host cells of Mycobacterium leprae, the causative agent of leprosy. Component of Lewy bodies, intraneuronal inclusions found in the brain of Parkinson disease patients.
- Q96M98 PACRG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN
Research Backgrounds
Suppresses cell death induced by accumulation of unfolded Pael receptor (Pael-R, a substrate of Parkin). Facilitates the formation of inclusions consisting of Pael-R, molecular chaperones, protein degradation molecules and itself when proteasome is inhibited. May play an important role in the formation of Lewy bodies and protection of dopaminergic neurons against Parkinson disease.
Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyte-derived macrophages the primary host cells of Mycobacterium leprae, the causative agent of leprosy. Component of Lewy bodies, intraneuronal inclusions found in the brain of Parkinson disease patients.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.