HOXB6 Antibody - #DF14509
| Product: | HOXB6 Antibody |
| Catalog: | DF14509 |
| Description: | Rabbit polyclonal antibody to HOXB6 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 25kD(Calculated). |
| Uniprot: | P17509 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
HGNC:5117; Homeo box 2B; homeo box B6; Homeobox B6; Homeobox protein Hox B6; Homeobox protein Hox-2.2; Homeobox protein Hox-2B; Homeobox protein Hox-B6; Homeobox protein Hu-2; Hox-2.2; HOX2; HOX2B; hoxb6; HU-2; HXB6_HUMAN;
Immunogens
A synthesized peptide derived from human HOXB6.
- P17509 HXB6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Nucleus.
Belongs to the Antp homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.