EAF2 Antibody - #DF14513
| Product: | EAF2 Antibody |
| Catalog: | DF14513 |
| Description: | Rabbit polyclonal antibody to EAF2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 29kD(Calculated). |
| Uniprot: | Q96CJ1 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
BM 040; BM040; EAF 2; EAF2; EAF2_HUMAN; Ehrlich S II transcriptional activator factor; ELL associated factor 2; ELL-associated factor 2; Festa; Testosterone regulated apoptosis inducer and tumor suppressor; Testosterone regulated apoptosis inducer and tumor suppressor protein; Testosterone-regulated apoptosis inducer and tumor suppressor protein; TRAITS; U19; Uncharacterized bone marrow protein BM 040; Uncharacterized bone marrow protein BM040;
Immunogens
A synthesized peptide derived from human EAF2.
Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes.
- Q96CJ1 EAF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
Research Backgrounds
Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.
Nucleus speckle.
Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes.
Belongs to the EAF family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.