14-3-3 zeta/delta Antibody | Affinity Biosciences

WB
IF/ICC

1/3

Western blot analysis on mouse brain lysates using 14-3-3 beta/ζ Antibody.

Western blot analysis of extracts from Rat liver, using 14-3-3 zeta/delta Antibody.

Product:	14-3-3 zeta/delta Antibody
Catalog:	AF0097
Description:	Rabbit polyclonal antibody to 14-3-3 zeta/delta
Application:	WB IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.:	28kDa; 28kD(Calculated).
Uniprot:	P63104 \| P31946
RRID:	AB_2833278

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Pig(100%), Zebrafish(89%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%)

Clonality:

Polyclonal

Specificity:

14-3-3 zeta/delta Antibody detects endogenous levels of total 14-3-3 zeta/delta.

RRID:

AB_2833278
Cite Format: Affinity Biosciences Cat# AF0097, RRID:AB_2833278.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

14 3 3 delta; 14 3 3 protein zeta/delta; 14 3 3 protein/cytosolic phospholipase A2; 14 3 3 zeta; 14-3-3 protein zeta/delta; 1433Z_HUMAN; Epididymis luminal protein 4; Epididymis secretory protein Li 3; HEL S 3; HEL4; KCIP-1; KCIP1; MGC111427; MGC126532; MGC138156; Phospholipase A2; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, zeta polypeptide; Tyrosine 3/tryptophan 5 monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ; 14 3 3 alpha; 14 3 3 protein beta/alpha; 14-3-3 protein beta/alpha; 1433B_HUMAN; Brain protein 14 3 3 beta isoform; GW128; HS 1; KCIP-1; KCIP1; N-terminally processed; Protein 1054; Protein kinase C inhibitor protein 1; YWHAA; YWHAB;

Immunogens

Immunogen:

Uniprot:

P63104(1433Z_HUMAN) >>Visit HPA database.

P31946(1433B_HUMAN) >>Visit HPA database.

Gene(ID):

YWHAZ(7534) | YWHAB(7529)

Description:

14-3-3 zeta a protein of the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. A multifunctional regulator of the cell signaling processes. Phosphorylation apparently disrupts homodimerization.

Sequence:

P63104 1433Z_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

P31946 1433B_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

100

Horse

100

Bovine

100

Sheep

100

Dog

100

Chicken

100

Rabbit

100

Zebrafish

Xenopus

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P63104/P31946 As Substrate

P63104
P31946

Site	PTM Type	Enzyme	Source
M1	Acetylation		Uniprot
K3	Acetylation		Uniprot
K3	Methylation		Uniprot
K3	Ubiquitination		Uniprot
K9	Acetylation		Uniprot
K9	Ubiquitination		Uniprot
K11	Acetylation		Uniprot
K11	Ubiquitination		Uniprot
Y19	Phosphorylation		Uniprot
C25	S-Nitrosylation		Uniprot
K27	Ubiquitination		Uniprot
S28	Phosphorylation		Uniprot
S37	Phosphorylation		Uniprot
S45	Phosphorylation		Uniprot
Y48	Phosphorylation		Uniprot
K49	Acetylation		Uniprot
K49	Methylation		Uniprot
K49	Ubiquitination		Uniprot
S57	Phosphorylation		Uniprot
S58	Phosphorylation	P31749 (AKT1) , P49137 (MAPKAPK2) , P17612 (PRKACA) , O00506 (STK25) , Q05655 (PRKCD)	Uniprot
S63	Phosphorylation		Uniprot
S64	Phosphorylation		Uniprot
K68	Acetylation		Uniprot
K68	Ubiquitination		Uniprot
K74	Acetylation		Uniprot
K74	Ubiquitination		Uniprot
K75	Acetylation		Uniprot
K75	Ubiquitination		Uniprot
Y82	Phosphorylation		Uniprot
K85	Acetylation		Uniprot
K85	Methylation		Uniprot
K85	Ubiquitination		Uniprot
T88	Phosphorylation		Uniprot
C94	S-Nitrosylation		Uniprot
S99	Phosphorylation		Uniprot
K103	Ubiquitination		Uniprot
S110	Phosphorylation		Uniprot
S114	Phosphorylation		Uniprot
K115	Acetylation		Uniprot
K115	Ubiquitination		Uniprot
K120	Acetylation		Uniprot
K120	Ubiquitination		Uniprot
K122	Ubiquitination		Uniprot
Y125	Phosphorylation		Uniprot
Y126	Phosphorylation		Uniprot
Y128	Phosphorylation		Uniprot
K138	Acetylation		Uniprot
K138	Ubiquitination		Uniprot
K139	Acetylation		Uniprot
K139	Ubiquitination		Uniprot
S145	Phosphorylation		Uniprot
Y149	Phosphorylation		Uniprot
K157	Acetylation		Uniprot
K157	Ubiquitination		Uniprot
K158	Ubiquitination		Uniprot
Y178	Phosphorylation		Uniprot
S184	Phosphorylation	P53779 (MAPK10) , P45984 (MAPK9) , P45983 (MAPK8)	Uniprot
C189	S-Nitrosylation		Uniprot
K193	Ubiquitination		Uniprot
T194	Phosphorylation		Uniprot
T205	Phosphorylation		Uniprot
S207	Phosphorylation		Uniprot
S210	Phosphorylation		Uniprot
Y211	Phosphorylation		Uniprot
K212	Methylation		Uniprot
S214	Phosphorylation		Uniprot
T215	Phosphorylation		Uniprot
T229	Phosphorylation		Uniprot
S230	Phosphorylation		Uniprot
T232	Phosphorylation	P48729 (CSNK1A1) , P11274 (BCR)	Uniprot

Site	PTM Type	Enzyme	Source
M1	Acetylation		Uniprot
T2	Acetylation		Uniprot
T2	Phosphorylation		Uniprot
K5	Acetylation		Uniprot
K5	Ubiquitination		Uniprot
S6	Phosphorylation		Uniprot
K11	Ubiquitination		Uniprot
K13	Acetylation		Uniprot
K13	Ubiquitination		Uniprot
Y21	Phosphorylation		Uniprot
K29	Ubiquitination		Uniprot
T32	Phosphorylation		Uniprot
S39	Phosphorylation		Uniprot
S47	Phosphorylation		Uniprot
Y50	Phosphorylation		Uniprot
K51	Acetylation		Uniprot
K51	Methylation		Uniprot
K51	Ubiquitination		Uniprot
S59	Phosphorylation		Uniprot
S60	Phosphorylation	Q05655 (PRKCD)	Uniprot
S66	Phosphorylation		Uniprot
K70	Acetylation		Uniprot
K70	Ubiquitination		Uniprot
K77	Acetylation		Uniprot
K82	Acetylation		Uniprot
K82	Ubiquitination		Uniprot
K87	Ubiquitination		Uniprot
K105	Ubiquitination		Uniprot
Y106	Phosphorylation		Uniprot
S116	Phosphorylation		Uniprot
K117	Acetylation		Uniprot
K117	Ubiquitination		Uniprot
Y120	Phosphorylation		Uniprot
K122	Acetylation		Uniprot
K122	Ubiquitination		Uniprot
K124	Ubiquitination		Uniprot
Y127	Phosphorylation		Uniprot
Y130	Phosphorylation		Uniprot
S132	Phosphorylation	O14920 (IKBKB)	Uniprot
S136	Phosphorylation		Uniprot
K140	Ubiquitination		Uniprot
Y151	Phosphorylation		Uniprot
K159	Acetylation		Uniprot
K159	Ubiquitination		Uniprot
K160	Ubiquitination		Uniprot
Y180	Phosphorylation		Uniprot
S186	Phosphorylation	P45983 (MAPK8)	Uniprot
K195	Ubiquitination		Uniprot
T207	Phosphorylation		Uniprot
S212	Phosphorylation		Uniprot
Y213	Phosphorylation		Uniprot
S216	Phosphorylation		Uniprot
T217	Phosphorylation		Uniprot
T228	Phosphorylation		Uniprot
T231	Phosphorylation		Uniprot
S232	Phosphorylation		Uniprot

Research Backgrounds

P63104_1433Z_HUMAN
P31946_1433B_HUMAN

Function:

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Induces ARHGEF7 activity on RAC1 as well as lamellipodia and membrane ruffle formation. In neurons, regulates spine maturation through the modulation of ARHGEF7 activity (By similarity).

PTMs:

The delta, brain-specific form differs from the zeta form in being phosphorylated (By similarity). Phosphorylation on Ser-184 by MAPK8; promotes dissociation of BAX and translocation of BAX to mitochondria. Phosphorylation on Thr-232; inhibits binding of RAF1. Phosphorylated on Ser-58 by PKA and protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion. Phosphorylation on Ser-58 by PKA; disrupts homodimerization and heterodimerization with YHAE and TP53.

Subcellular Location:

Cytoplasm. Melanosome.
Note: Located to stage I to stage IV melanosomes.

Subunit Structure:

Interacts with CDK16 and BSPRY (By similarity). Interacts with WEE1 (C-terminal). Interacts with SAMSN1 (By similarity). Interacts with MLF1 (phosphorylated form); the interaction retains it in the cytoplasm (By similarity). Interacts with Thr-phosphorylated ITGB2 (By similarity). Interacts with BCL2L11 (By similarity). Homodimer. Heterodimerizes with YWHAE. Homo- and heterodimerization is inhibited by phosphorylation on Ser-58. Interacts with FOXO4, NOXA1, SSH1 and ARHGEF2. Interacts with Pseudomonas aeruginosa exoS (unphosphorylated form). Interacts with BAX; the interaction occurs in the cytoplasm. Under stress conditions, MAPK8-mediated phosphorylation releases BAX to mitochondria. Interacts with phosphorylated RAF1; the interaction is inhibited when YWHAZ is phosphorylated on Thr-232. Interacts with BRAF. Interacts with TP53; the interaction enhances p53 transcriptional activity. The Ser-58 phosphorylated form inhibits this interaction and p53 transcriptional activity. Interacts with ABL1 (phosphorylated form); the interaction retains ABL1 in the cytoplasm. Interacts with PKA-phosphorylated AANAT; the interaction modulates AANAT enzymatic activity by increasing affinity for arylalkylamines and acetyl-CoA and protecting the enzyme from dephosphorylation and proteasomal degradation. It may also prevent thiol-dependent inactivation. Interacts with AKT1; the interaction phosphorylates YWHAZ and modulates dimerization. Interacts with GAB2 and TLK2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with ZFP36L1 (via phosphorylated form); this interaction occurs in a p38 MAPK- and AKT-signaling pathways (By similarity). Interacts with SLITRK1. Interacts with AK5, LDB1, MADD, MARK3, PDE1A and SMARCB1.

Family&Domains:

Belongs to the 14-3-3 family.

Function:

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negative regulator of osteogenesis. Blocks the nuclear translocation of the phosphorylated form (by AKT1) of SRPK2 and antagonizes its stimulatory effect on cyclin D1 expression resulting in blockage of neuronal apoptosis elicited by SRPK2. Negative regulator of signaling cascades that mediate activation of MAP kinases via AKAP13.

PTMs:

The alpha, brain-specific form differs from the beta form in being phosphorylated. Phosphorylated on Ser-60 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.

Subcellular Location:

Cytoplasm. Melanosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV.

Vacuole membrane.
Note: (Microbial infection) Upon infection with Chlamydia trachomatis, this protein is associated with the pathogen-containing vacuole membrane where it colocalizes with IncG.

Subunit Structure:

Homodimer. Interacts with SAMSN1 and PRKCE (By similarity). Interacts with AKAP13. Interacts with SSH1 and TORC2/CRTC2. Interacts with ABL1; the interaction results in cytoplasmic location of ABL1 and inhibition of cABL-mediated apoptosis. Interacts with ROR2 (dimer); the interaction results in phosphorylation of YWHAB on tyrosine residues. Interacts with GAB2. Interacts with YAP1 (phosphorylated form). Interacts with the phosphorylated (by AKT1) form of SRPK2. Interacts with PKA-phosphorylated AANAT. Interacts with MYO1C. Interacts with SIRT2. Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with the 'Ser-1134' and 'Ser-1161' phosphorylated form of SOS1. Interacts (via phosphorylated form) with YWHAB; this interaction occurs in a protein kinase AKT1-dependent manner. Interacts with SLITRK1. Interacts with SYNPO2 (phosphorylated form); YWHAB competes with ACTN2 for interaction with SYNPO2 (By similarity). Interacts with RIPOR2 (via phosphorylated form) isoform 2; this interaction occurs in a chemokine-dependent manner and does not compete for binding of RIPOR2 with RHOA nor blocks inhibition of RIPOR2-mediated RHOA activity. Interacts with MARK2 and MARK3.

(Microbial infection) Interacts with herpes simplex virus 1 protein UL46.

(Microbial infection) Probably interacts with Chlamydia trachomatis protein IncG.

Family&Domains:

Belongs to the 14-3-3 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

· Human Diseases > Infectious diseases: Viral > Hepatitis B.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

14-3-3 zeta/delta Antibody - #AF0097