PI3 Antibody - #DF14564

Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cementoin; ELAF_HUMAN; Elafin; Elafin/Skalp; Elastase Specific Inhibitor; Elastase-specific inhibitor; ES 1; ESI; Peptidase inhibitor 3; Peptidase inhibitor 3, skin derived; PI 3; PI-3; PI3; Pre elafin; Protease inhibitor 3 skin derived; Protease inhibitor 3, skin derived (SKALP); Protease inhibitor WAP3; SKALP; Skin derived Anti leukoproteinase; Skin-derived antileukoproteinase; Trappin 2; WAP four disulfide core domain 14; WAP four disulfide core domain protein 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14;
Immunogens
A synthesized peptide derived from human PI3.
- P19957 ELAF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Research Backgrounds
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1).
Secreted.
Consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize elafin covalently to specific sites on extracellular matrix proteins.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.