MSRB1 Antibody - #DF14643
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Annexin A2 like; EC 1 8 4; HSPC 270; HSPC270; Methionine R sulfoxide reductase; Methionine R sulfoxide reductase B1; Methionine sulfoxide reductase; Methionine-R-sulfoxide reductase B1; MGC3344; MSRB 1; MsrB1; MSRB1_HUMAN; OTTHUMP00000159418; Sel X; Selenoprotein R; Selenoprotein X 1; Selenoprotein X; Selenoprotein X1; SELR; SelX; SEPX 1; sepx1;
Immunogens
A synthesized peptide derived from human MSRB1.
- Q9NZV6 MSRB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH
Research Backgrounds
Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Acts as a regulator of actin assembly by reducing methionine (R)-sulfoxide mediated by MICALs (MICAL1, MICAL2 or MICAL3) on actin, thereby promoting filament repolymerization. Plays a role in innate immunity by reducing oxidized actin, leading to actin repolymerization in macrophages.
Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton.
Belongs to the MsrB Met sulfoxide reductase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.