Product: EMP3 Antibody
Catalog: DF14661
Description: Rabbit polyclonal antibody to EMP3
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 18kD(Calculated).
Uniprot: P54852

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
EMP3 Antibody detects endogenous levels of EMP3.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

EMP 3; EMP-3; Emp3; EMP3_HUMAN; Epithelial membrane protein 3; Hematopoietic neural membrane protein 1; Hematopoietic neural membrane protein; HGNC:3335; HNMP 1; HNMP-1; Protein YMP; YMP; YMP protein;

Immunogens

Immunogen:

A synthesized peptide derived from human EMP3.

Uniprot:
Gene(ID):
Sequence:
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE

Research Backgrounds

Function:

Probably involved in cell proliferation and cell-cell interactions.

Subcellular Location:

Membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the PMP-22/EMP/MP20 family.

References

1). EMP3 as a prognostic biomarker correlates with EMT in GBM. BMC cancer, 2024 (PubMed: 38229014) [IF=3.8]

Application: WB    Species: human    Sample:

Fig. 5 Knockdown of EMP3 inhibits the malignant phenotypes of glioblastomas (A) and (B). The expression of EMP3 was significantly reduced after transfection of U87 and U251 cells for 72 h cultured with siRNA, and GAPDH was used as an internal control (C) and (D). The proliferation rate of U87 and U251 cells in the si-EMP3 group was significantly lower than that of the NC group at 24 h, 48 h, 72 h (E). The number of migrating U87 and U251 cells in the si-EMP3 group was lower than that in the NC group at 72-96 h (F). Wound healing results indicated the migration capacity of the si-NRP1 group was significantly lower than that of the NC group at 72-96 h.The knockdown efficiency of EMP3 in U251 glioma cells are detected by western blot (G). Cells were divided into four groups, NC (negtive control) group, siRNA EMP3-1, siRNA EMP3-2 and siRNA EMP3-3 group. U251 cells were lysis after siRNA incubation for 72 h. All of the full-length blots/gels of WB are presented in Supplementary Figure 1A and B. *p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.