P2RX4 Antibody - #DF14687
| Product: | P2RX4 Antibody |
| Catalog: | DF14687 |
| Description: | Rabbit polyclonal antibody to P2RX4 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 43kD(Calculated). |
| Uniprot: | Q99571 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
AI504491; ATP gated cation channel protein; ATP receptor; AW555605; D5Ertd444e; fi03f02; MGC143034; OTTMUSP00000023741; OTTMUSP00000023745; OTTMUSP00000023746; OTTMUSP00000023747; P2rx4; P2RX4_HUMAN; P2X purinoceptor 4; P2X receptor subunit 4; P2X4; P2X4R; Purinergic receptor; Purinergic receptor P2X ligand gated ion channel 4; Purinergic receptor P2X4; Purinoceptor P2X4; wu:fi03f02;
Immunogens
A synthesized peptide derived from human P2RX4.
- Q99571 P2RX4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Research Backgrounds
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin.
Membrane>Multi-pass membrane protein.
Belongs to the P2X receptor family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.