AKIRIN1 Antibody - #DF14690
| Product: | AKIRIN1 Antibody |
| Catalog: | DF14690 |
| Description: | Rabbit polyclonal antibody to AKIRIN1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 22kD(Calculated). |
| Uniprot: | Q9H9L7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
AKIR1_HUMAN; AKIRIN 1; Akirin-1; Akirin1; C1orf108; FLJ12666; OTTHUMP00000008669; RP11-781D11.2; STRF2;
Immunogens
A synthesized peptide derived from human AKIRIN1.
Widely expressed with the highest expression in heart, liver, placenta and peripheral blood leukocytes.
- Q9H9L7 AKIR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS
Research Backgrounds
Functions as signal transducer for MSTN during skeletal muscle regeneration and myogenesis. May regulate chemotaxis of both macrophages and myoblasts by reorganising actin cytoskeleton, leading to more efficient lamellipodia formation via a PI3 kinase dependent pathway.
Nucleus.
Widely expressed with the highest expression in heart, liver, placenta and peripheral blood leukocytes.
Belongs to the akirin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.