NUCKS1 Antibody - #DF14692
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
FLJ21480; FLJ32016; FLJ38536; JC7; NUCKS 1; NUCKS; NUCKS_HUMAN; Nucks1; Nuclear casein kinase and cyclin dependent kinase substrate 1; Nuclear ubiquitous casein and cyclin dependent kinases substrate; Nuclear ubiquitous casein and cyclin-dependent kinases substrate; Nuclear ubiquitous casein kinase and cyclin dependent kinase substrate; P1; Potential LAG1 interactor;
Immunogens
A synthesized peptide derived from human NUCKS1.
Widely expressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung.
- Q9H1E3 NUCKS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
Research Backgrounds
Phosphorylated by CDK1 and casein kinase.
Nucleus.
Widely expressed, with highest levels in thyroid gland, prostate and uterus and in fetal liver, thymus and lung.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.