SMARCD2 Antibody - #DF14724
| Product: | SMARCD2 Antibody |
| Catalog: | DF14724 |
| Description: | Rabbit polyclonal antibody to SMARCD2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 59kD(Calculated). |
| Uniprot: | Q92925 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
60 kDa BRG 1/Brm associated factor subunit B; 60 kDa BRG1/Brm associated factor subunit B; BAF60B; BRG1 associated factor 60B; Chromatin remodeling complex BAF60B subunit; CRACD 2; CRACD2; Mammalian chromatin remodeling complex BRG1 associated factor 60B; PRO2451; Rsc6p; SMARCD 2; SWI/SNF complex 60 kDa subunit B; SWI/SNF related matrix associated actin dependent regulator of chromatin d2; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily d member 2; Swp73 like protein;
Immunogens
A synthesized peptide derived from human SMARCD2.
- Q92925 SMRD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFRPMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Research Backgrounds
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Critical regulator of myeloid differentiation, controlling granulocytopoiesis and the expression of genes involved in neutrophil granule formation.
Ubiquitinated through a signaling process involving RAC1 and the RING finger protein UNKL.
Nucleus.
Isoform 2 is expressed in the pancreas.
Belongs to the SMARCD family.
Research Fields
· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.