MYF6 Antibody - #DF14733
Product: | MYF6 Antibody |
Catalog: | DF14733 |
Description: | Rabbit polyclonal antibody to MYF6 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 27kD(Calculated). |
Uniprot: | P23409 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
bHLHc4; Class C basic helix-loop-helix protein 4; CNM3; HERCULIN; MRF4; Muscle-regulatory factor 4; Muscle-specific regulatory factor 4; Myf-6; Myf6; MYF6_HUMAN; myogenic factor 6 (herculin); Myogenic factor 6;
Immunogens
A synthesized peptide derived from human MYF6.
- P23409 MYF6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK
Research Backgrounds
Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
Nucleus.
Skeletal muscle.
Efficient DNA binding requires dimerization with another bHLH protein. Interacts with CSRP3.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.