NKX3-2 Antibody - #DF14738
| Product: | NKX3-2 Antibody |
| Catalog: | DF14738 |
| Description: | Rabbit polyclonal antibody to NKX3-2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 35kD(Calculated). |
| Uniprot: | P78367 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Bagpipe homeobox 1; Bagpipe homeobox homolog 1; Bagpipe homeobox protein homolog 1; Bagpipe homeobox, Drosophila, homolog of, 1; BAPX 1; Homeobox protein NK-3 homolog B; Homeobox protein Nkx 3.2; Homeobox protein Nkx-3.2; MGC138171; NK3 homeobox 2; NKX3 2; NKX3-2; NKX3.2; NKX3.2, mouse, homolog of; NKX32_HUMAN; NKX3B; OTTHUMP00000115816; SMMD;
Immunogens
A synthesized peptide derived from human NKX3-2.
Expressed at highest levels in cartilage, bone (osteosarcoma) and gut (small intestine and colon), whereas moderate expression is seen in trachea and brain. Expressed in visceral mesoderm and embryonic skeleton.
- P78367 NKX32_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Research Backgrounds
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus (By similarity).
Nucleus.
Expressed at highest levels in cartilage, bone (osteosarcoma) and gut (small intestine and colon), whereas moderate expression is seen in trachea and brain. Expressed in visceral mesoderm and embryonic skeleton.
Belongs to the NK-3 homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.