ULBP1 Antibody - #DF14795
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Alcan beta; ALCAN-beta; N2DL-1; N2DL1; N2DL1_HUMAN; NKG2D ligand 1; NKG2D ligand 1 precursor; NKG2DL1; RAET1I; Retinoic acid early transcript 1I; UL16; UL16 binding protein 1; UL16-binding protein 1; ULBP1;
Immunogens
A synthesized peptide derived from human ULBP1.
Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
- Q9BZM6 ULBP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR
Research Backgrounds
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Cell membrane>Lipid-anchor. Endoplasmic reticulum.
Note: In CMV-infected fibroblasts, detected in the endoplasmic reticulum/cis-Golgi.
Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
Belongs to the MHC class I family.
Research Fields
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.