RNASE1 Antibody - #DF14814
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
HP-RNase; Pancreatic ribonuclease; Rib 1; RIB-1; Rib1; Ribonuclease 1; Ribonuclease A; Ribonuclease a family 1; Ribonuclease pancreatic; Ribonuclease RNase A family 1; Ribonuclease RNase A family 1 pancreatic; RNAS1_HUMAN; RNase 1; RNase A; RNase UpI-1; Rnase1; RNAseA;
Immunogens
A synthesized peptide derived from human RNASE1.
Pancreas and other tissues and body fluids (indicating it may have other physiological functions besides its role in digestion).
- P07998 RNAS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Research Backgrounds
Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA.
N-linked glycans are of complex type.
Secreted.
Pancreas and other tissues and body fluids (indicating it may have other physiological functions besides its role in digestion).
Belongs to the pancreatic ribonuclease family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.