Product: HPGD Antibody
Catalog: DF14850
Description: Rabbit polyclonal antibody to HPGD
Application: IHC IF/ICC
Cited expt.: IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 29kD(Calculated).
Uniprot: P15428

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
HPGD Antibody detects endogenous levels of HPGD.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

15 hydroxyprostaglandin dehydrogenase [NAD+]; 15 PGDH; 15-hydroxyprostaglandin dehydrogenase [NAD+]; 15-PGDH; 15PGDH; Hpgd; Hydroxyprostaglandin dehydrogenase 15 (NAD); NAD+ dependent 15 hydroxyprostaglandin dehydrogenase; OTTHUMP00000218960; OTTHUMP00000219016; OTTHUMP00000219018; PGDH; PGDH_HUMAN; PGDH1; PHOAR1; Prostaglandin dehydrogenase 1; SDR36C1; Short chain dehydrogenase/reductase family 36C member 1;

Immunogens

Immunogen:

A synthesized peptide derived from human HPGD.

Uniprot:
Gene(ID):
Expression:
P15428 PGDH_HUMAN:

Detected in colon epithelium (at protein level).

Sequence:
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Research Backgrounds

Function:

Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in colon epithelium (at protein level).

Family&Domains:

Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Research Fields

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

References

1). Microglia Exhibit Distinct Heterogeneity Rather than M1/M2 Polarization within the Early Stage of Acute Ischemic Stroke. Aging and disease, 2023 (PubMed: 37199734) [IF=7.0]

Application: IF/ICC    Species: Mouse    Sample:

Figure 3. Subpopulation analysis of microglia clusters under homeostatic conditions. (A) Pseudotime plot (from monocle3) shows the differentiation trajectory from Mic_home to Mic_pre2 cells. (B) Line plot of the fraction of cells in the Mic_home, Mic_pre1, and Mic_pre2 subpopulations over time. (C) Expression of the ten genes with the highest Moran’s I score alongside the pseudotime trajectory. (D) Venn plot of the mutual and unique marker genes for the Mic_home, Mic_pre1, and Mic_pre2 subpopulations. (E) Volcano plot displays the differentially expressed genes between Mic_home and Mic_pre2 cells. Red dots represent the upregulated genes in the Mic_home cluster compared with the Mic_pre2 cluster and blue dots represent the downregulated genes. (F) Violin plot of the gene set variation analysis (GSVA) scores for important functional pathways of the Mic_home, Mic_pre1, and Mic_pre2 subpopulations. (G) Double immunofluorescence staining of Mic_home cells at each sampling time. Coronal brain sections are all stained with anti-Iba1(green, representing microglia), DAPI (blue, representing cell nuclei), and Hpgd (red, representing the marker of Mic_home cells) antibodies (N=3). The yellow bar represents 100μm. (H) Double immunofluorescence staining of Mic_pre2 cells at each sampling time. Coronal brain sections are all stained with anti-Iba1(green, representing microglia), DAPI (blue, representing cell nuclei), and Wsb1 (red, representing the marker of Mic_pre2 cells) antibodies (N=3). The yellow bar represents 100μm. (I) Bar plot of the ratio of Hpgd+Iba1+ cells (green plus red) compared with all DAPI+ cells in a 500μm2 area surrounding the infarction core (N=6). (J) Bar plot of the ratio of Wsb1+Iba1+ cells (green plus red) compared with DAPI+ cells in a 500μm2 area surrounding the infarction core (N=6).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.