ESM1 Antibody - #DF14935
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Endocan; Endothelial cell specific molecule 1; Endothelial cell-specific molecule 1; ESM 1; ESM 1 secretory protein; ESM-1; Esm1; ESM1 secretory protein; ESM1_HUMAN;
Immunogens
A synthesized peptide derived from human ESM1.
Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
- Q9NQ30 ESM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Research Backgrounds
Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions.
May contain intrachain disulfide bonds.
O-glycosylated; contains chondroitin sulfate and dermatan sulfate.
Secreted.
Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.