C1orf43 Antibody - #DF14945
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
4933434E20Rik; AI462154; C1orf43; CA043_HUMAN; Chromosome 1 open reading frame 43; HCV NS5A transactivated protein 4; HCV NS5A-transactivated protein 4; Hepatitis C virus NS5A transactivated protein 4; Hepatitis C virus NS5A-transactivated protein 4; HSPC012; Hypothetical protein LOC25912; MGC111001; NICE 3; NICE3; NS5ATP4; OTTHUMP00000034199; OTTHUMP00000034201; OTTHUMP00000034202; Protein NICE 3; Protein NICE-3; Riken cDNA 4933434E20; S863 3; S863-3; Uncharacterized protein C1orf43;
Immunogens
A synthesized peptide derived from human C1orf43.
- Q9BWL3 CA043_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
Research Backgrounds
Membrane>Single-pass membrane protein.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.