CTDSPL Antibody - #DF14953
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C3orf8; Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like; CTD small phosphatase-like protein; CTDSL_HUMAN; CTDSP-like; Ctdspl; hYA22; N-like protein; NIF-like protein; NLI-interacting factor 1; Nuclear LIM interactor-interacting factor 1; Protein YA22; RB protein serine phosphatase from chromosome 3; RBSP3; SCP3; Small C-terminal domain phosphatase 3; Small CTD phosphatase 3;
Immunogens
A synthesized peptide derived from human CTDSPL.
- O15194 CTDSL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
Research Backgrounds
Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells (By similarity). Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation.
Nucleus.
Expression is restricted to non-neuronal tissues.
Interacts with REST (By similarity). Monomer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.