SPACA7 Antibody - #DF14964
| Product: | SPACA7 Antibody |
| Catalog: | DF14964 |
| Description: | Rabbit polyclonal antibody to SPACA7 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 21kD(Calculated). |
| Uniprot: | Q96KW9 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Chromosome 13 open reading frame 28; FLJ27356; Protein SPACA7; SPAC7_HUMAN; Spaca7; Sperm acrosome-associated protein 7;
Immunogens
A synthesized peptide derived from human SPACA7.
- Q96KW9 SPAC7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEVKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ
Research Backgrounds
Involved in fertilization. Seems not to play a direct role in sperm-egg binding or gamete fusion.
Secreted. Cytoplasmic vesicle>Secretory vesicle>Acrosome. Cytoplasmic vesicle>Secretory vesicle>Acrosome lumen.
Note: Localized in perinuclear pro-acrosomal granules in round spermatides. Localized between the inner and outer acrosomal membranes (matrix or lumen) in spermatozoa. Secreted during acrosome exocytosis.
Expressed in spermatozoa (at protein level).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.