INCA1 Antibody - #DF14976
| Product: | INCA1 Antibody |
| Catalog: | DF14976 |
| Description: | Rabbit polyclonal antibody to INCA1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 27kD(Calculated). |
| Uniprot: | Q0VD86 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
HSD45; Inca1; INCA1_HUMAN; Inhibitor of CDK cyclin A1 interacting protein 1; Inhibitor of CDK interacting with cyclin A1; MGC148150; MGC148151; Protein INCA1;
Immunogens
A synthesized peptide derived from human INCA1.
Detected in testis, and at lower levels in ovary. Detected at very low levels in testis tumors (PubMed:15159402). Down-regulated in bone marrow cells in acute myeloid and lymphoid leukemia patients as compared with normal bone marrow cells (PubMed:21540187).
- Q0VD86 INCA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATGCSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE
Research Backgrounds
Binds to CDK2-bound cyclins and inhibits the kinase activity of CDK2; binding to cyclins is critical for its function as CDK inhibitor. Inhibits cell growth and cell proliferation and may play a role in cell cycle control (By similarity). Required for ING5-mediated regulation of S-phase progression, enhancement of Fas-induced apoptosis and inhibition of cell growth (By similarity).
Phosphorylated when part of a complex with CCNA1 and CDK2. Strongly phosphorylated by CDK2 on its C-terminal region spanning amino acid 149-221. Less intensively phosphorylated by CDK2 on its first 75 amino acid residues.
Nucleus. Cytoplasm.
Detected in testis, and at lower levels in ovary. Detected at very low levels in testis tumors. Down-regulated in bone marrow cells in acute myeloid and lymphoid leukemia patients as compared with normal bone marrow cells.
Belongs to the INCA family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.