TMEM18 Antibody - #DF14985
Product: | TMEM18 Antibody |
Catalog: | DF14985 |
Description: | Rabbit polyclonal antibody to TMEM18 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 16kD(Calculated). |
Uniprot: | Q96B42 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DKFZp434C1714; TMEM18; TMM18_HUMAN; Transmembrane protein 18;
Immunogens
A synthesized peptide derived from human TMEM18.
- Q96B42 TMM18_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED
Research Backgrounds
Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).
Cytoplasm. Nucleus membrane>Multi-pass membrane protein.
Forms homooligomers, independently of the DNA-binding domain.
Belongs to the TMEM18 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.