RSRC1 Antibody - #DF14990
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1200013F24Rik; Arginine/serine rich coiled coil 1; Arginine/serine-rich coiled-coil protein 1; BM 011; MGC103357; MGC12197; OTTHUMP00000213444; OTTHUMP00000213446; OTTHUMP00000213451; RGD1304968; Rsrc1; RSRC1_HUMAN; Serine/Arginine-related protein 53; SFRS21; Splicing factor arginine/serine rich 21; SRrp53;
Immunogens
A synthesized peptide derived from human RSRC1.
- Q96IZ7 RSRC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRLRSHSRSSERSSHRRTRSRSRDRERRKGRDKEKREKEKDKGKDKELHNIKRGESGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA
Research Backgrounds
Has a role in alternative splicing and transcription regulation. Involved in both constitutive and alternative pre-mRNA splicing. May have a role in the recognition of the 3' splice site during the second step of splicing.
Phosphorylated.
Nucleus. Nucleus speckle. Cytoplasm.
Note: Shuttles between the nucleus and cytoplasm.
Widely expressed. Expressed in brain, spinal cord, cerebellum.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.