Product: RNASE6 Antibody
Catalog: DF15080
Description: Rabbit polyclonal antibody to RNASE6
Application: IHC IF/ICC
Reactivity: Human
Mol.Wt.: 17kD(Calculated).
Uniprot: Q93091

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
RNASE6 Antibody detects endogenous levels of RNASE6.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Ribonuclease K6; RNAS6_HUMAN; RNase K6; RNASE6;

Immunogens

Immunogen:

A synthesized peptide derived from human RNASE6.

Uniprot:
Gene(ID):
Expression:
Q93091 RNAS6_HUMAN:

Highly expressed in spleen (at protein level) (PubMed:8836175, PubMed:25075772). Has little or no expression in healthy kidneys (at protein level) (PubMed:25075772). Detected in interstitial leukocytes in infected kidneys (at protein level) (PubMed:25075772). Expressed in ureter where it localizes to urothelial and submucosal leukocytes (at protein level) (PubMed:25075772). Strong expression in lung and thymus, and lower expression in heart, placenta, pancreas, liver, brain and skeletal muscle (PubMed:8836175, PubMed:25075772). Also expressed in monocytes and neutrophils (PubMed:8836175).

Sequence:
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Research Backgrounds

Function:

Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.

Subcellular Location:

Secreted. Lysosome. Cytoplasmic granule.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in spleen (at protein level). Has little or no expression in healthy kidneys (at protein level). Detected in interstitial leukocytes in infected kidneys (at protein level). Expressed in ureter where it localizes to urothelial and submucosal leukocytes (at protein level). Strong expression in lung and thymus, and lower expression in heart, placenta, pancreas, liver, brain and skeletal muscle. Also expressed in monocytes and neutrophils.

Family&Domains:

Belongs to the pancreatic ribonuclease family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.