TPPP2 Antibody - #DF15086
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C14orf8; Gm1790; Gm77; P18; p25beta; Protein p25-beta; RGD1566185; TPPP/p18; TPPP2; TPPP2_HUMAN; Tubulin polymerization-promoting protein family member 2;
Immunogens
A synthesized peptide derived from human TPPP2.
Expressed in spermatids (PubMed:23436708). Detected in liver cancer (at protein level) (PubMed:23436708).
- P59282 TPPP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK
Research Backgrounds
Probable regulator of microtubule dynamics required for sperm motility (Probable). In contrast to other members of the family, has no microtubule bundling activity.
Cytoplasm>Cytosol. Cell projection>Cilium>Flagellum.
Note: Present in the middle piece of sperm tail.
Expressed in spermatids. Detected in liver cancer (at protein level).
Belongs to the TPPP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.