EDARADD Antibody - #DF15113
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cr; Crinkled homolog; ectodysplasia A receptor associated death domain; Ectodysplasin-A receptor-associated adapter protein; ED3; EDA3; EDAD_HUMAN; EDAR associated death domain; EDAR-associated death domain protein; EDARADD; Protein crinkled homolog;
Immunogens
A synthesized peptide derived from human EDARADD.
Detected in adult pancreas, placenta and fetal skin, and at lower levels in lung, thymus, prostate and testis.
- Q8WWZ3 EDAD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
Research Backgrounds
Adapter protein that interacts with EDAR DEATH domain and couples the receptor to EDA signaling pathway during morphogenesis of ectodermal organs. Mediates the activation of NF-kappa-B.
Cytoplasm.
Detected in adult pancreas, placenta and fetal skin, and at lower levels in lung, thymus, prostate and testis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.