OSGEPL1 Antibody - #DF15152
Product: | OSGEPL1 Antibody |
Catalog: | DF15152 |
Description: | Rabbit polyclonal antibody to OSGEPL1 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 45kD(Calculated). |
Uniprot: | Q9H4B0 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
O sialoglycoprotein endopeptidase like 1; O sialoglycoprotein endopeptidase like protein 1; osgepl1; OSGP2_HUMAN; Probable O sialoglycoprotein endopeptidase 2; Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEPL1; Putative sialoglycoprotease type 2; Qri7; t(6)A37 threonylcarbamoyladenosine biosynthesis protein OSGEPL1;
Immunogens
A synthesized peptide derived from human OSGEPL1.
Widely expressed, with maximum expression in pituitary gland, prostate, rectum and uterus.
- Q9H4B0 OSGP2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTGLQHVTDKIIMKKEKEEGIEKGQILSSAADIAATVQHTMACHLVKRTHRAILFCKQRDLLPQNNAVLVASGGVASNFYIRRALEILTNATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGILHDIEGIRYEPKCPLGVDISKEVGEASIKVPQLKMEI
Research Backgrounds
Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in mitochondrial tRNAs that read codons beginning with adenine. Probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. Involved in mitochondrial genome maintenance.
Mitochondrion.
Widely expressed, with maximum expression in pituitary gland, prostate, rectum and uterus.
Homodimer.
Belongs to the KAE1 / TsaD family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.