FAM162A Antibody - #DF15168
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C3orf28; Chromosome 3 open reading frame 28; DC16; E2-induced gene 5 protein; E2IG5; F162A_HUMAN; Fam162a; Family with sequence similarity 162, member A1; Growth and transformation-dependent protein; HGTD P; HIF-1 alpha-responsive proapoptotic molecule; OTTHUMP00000215578; OTTHUMP00000215579; OTTHUMP00000215580; Protein FAM162A;
Immunogens
A synthesized peptide derived from human FAM162A.
- Q96A26 F162A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE
Research Backgrounds
Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly.
Membrane>Single-pass membrane protein. Mitochondrion.
Interacts with HSP90AB1; HSP90AB1 is essential for FAM162A mitochondrial localization and pro-apoptotic activity. Interacts with VDAC2; the interaction is probably involved in inducing mitochondrial permability transition.
Belongs to the UPF0389 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.