ANAPC16 Antibody - #DF15180
| Product: | ANAPC16 Antibody |
| Catalog: | DF15180 |
| Description: | Rabbit polyclonal antibody to ANAPC16 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 12kD(Calculated). |
| Uniprot: | Q96DE5 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
anapc16; Anaphase-promoting complex subunit 16; APC16; APC16_HUMAN; bA570G20.3; C10orf104; CENP-27; centromere protein 27; Chromosome 10 open reading frame 104; Cyclosome subunit 16; metabolic syndrome-associated gene; metabolic syndrome-associated protein; MSAG;
Immunogens
A synthesized peptide derived from human ANAPC16.
- Q96DE5 APC16_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG
Research Backgrounds
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Cytoplasm. Nucleus. Chromosome>Centromere>Kinetochore.
Belongs to the APC16 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.