PPTC7 Antibody - #DF15198
| Product: | PPTC7 Antibody |
| Catalog: | DF15198 |
| Description: | Rabbit polyclonal antibody to PPTC7 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 33kD(Calculated). |
| Uniprot: | Q8NI37 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
pptc7; PPTC7_HUMAN; Protein phosphatase PTC7 homolog; PTC7 protein phosphatase homolog (S. cerevisiae); T-cell activation protein phosphatase 2C; T-cell activation protein phosphatase 2C-like; TA-PP2C; TAPP2C;
Immunogens
A synthesized peptide derived from human PPTC7.
- Q8NI37 PPTC7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD
Research Backgrounds
Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q. Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation.
Mitochondrion matrix.
Expressed in keratinocytes (at protein level).
Belongs to the PP2C family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.