DLX1 Antibody - #DF15207
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DII B; Distal less homeo box 1; Distal less homeobox 1; Distal-less homeobox gene 1a; Dlx 1; Dlx; Dlx1; Dlx1 distal-less homeobox 1; DLX1_HUMAN; Homeo box protein DLX1; Homeobox protein DLX 1; Homeobox protein DLX-1; Homeobox protein Dlx1a; Homeodomain transcription factor DLX1; MGC189409; OTTHUMP00000082494; OTTHUMP00000082497; OTTMUSP00000014202; RP23-419H3.3;
Immunogens
A synthesized peptide derived from human DLX1.
- P56177 DLX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM
Research Backgrounds
Plays a role as a transcriptional activator or repressor. Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription factors, such as MSX2, FAST2, SMAD2 and SMAD3 during hematopoietic cell differentiation. Plays a role in terminal differentiation of interneurons, such as amacrine and bipolar cells in the developing retina (By similarity). Likely to play a regulatory role in the development of the ventral forebrain (By similarity). May play a role in craniofacial patterning and morphogenesis and may be involved in the early development of diencephalic subdivisions (By similarity).
Nucleus.
Expressed in hematopoietic cell lines.
The homeobox DNA-binding domain is necessary for its nuclear localization, transcriptional and erythroid differentiation activities (PubMed:14671321).
Belongs to the distal-less homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.