GIMAP6 Antibody - #DF15208
| Product: | GIMAP6 Antibody |
| Catalog: | DF15208 |
| Description: | Rabbit polyclonal antibody to GIMAP6 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 33kD(Calculated). |
| Uniprot: | Q6P9H5 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GIMA6_HUMAN; Gimap6; GTPase IMAP family member 6; hIAN2; hIAN6; Human immune associated nucleotide 2; IAN-2; IAN-6; IAN6; Immune associated nucleotide 2; Immune associated nucleotide 6; Immunity associated nucleotide 6 protein; Immunity-associated nucleotide 2 protein; Immunity-associated nucleotide 6 protein;
Immunogens
A synthesized peptide derived from human GIMAP6.
Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues. Detected in T-cells.
- Q6P9H5 GIMA6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
Research Backgrounds
Cytoplasm>Cytosol.
Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues. Detected in T-cells.
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. AIG1/Toc34/Toc159-like paraseptin GTPase family. IAN subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.