GPX2 Antibody - #DF15267
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Gastrointestinal glutathione peroxidase; GI GPx; Glutathione peroxidase 2 (gastrointestinal); Glutathione peroxidase 2; Glutathione peroxidase gastrointestinal; Glutathione peroxidase related protein 2; Glutathione peroxidase-gastrointestinal; Glutathione peroxidase-related protein 2; GPRP; GPRP-2; GPx 2; GPx-2; GPx-GI; GPX2; GPX2_HUMAN; GSHPx 2; GSHPx GI; GSHPx-2; GSHPx-GI;
Immunogens
A synthesized peptide derived from human GPX2.
- P18283 GPX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI
Research Backgrounds
Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors.
Cytoplasm.
Note: Mainly cytoplasmic.
Mostly in liver and gastrointestinal tract, not found in heart or kidney.
Belongs to the glutathione peroxidase family.
Research Fields
· Metabolism > Metabolism of other amino acids > Glutathione metabolism.
· Metabolism > Lipid metabolism > Arachidonic acid metabolism.
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.