TIMMDC1 Antibody - #DF15317
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C3orf1; M5 14 protein; Protein M5-14; TIDC1_HUMAN; TIMMDC 1; timmdc1; Translocase of inner mitochondrial membrane domain containing 1; Translocase of inner mitochondrial membrane domain containing protein 1; Translocase of inner mitochondrial membrane domain-containing protein 1; Transmembrane protein C3orf1;
Immunogens
A synthesized peptide derived from human TIMMDC1.
- Q9NPL8 TIDC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Research Backgrounds
Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.
Mitochondrion membrane>Multi-pass membrane protein.
Generalized expression enhanced in heart and skeletal muscle.
Associates with the intermediate 315 kDa subcomplex of incompletely assembled complex I.
Belongs to the Tim17/Tim22/Tim23 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.