DUSP23 Antibody - #DF15348
| Product: | DUSP23 Antibody |
| Catalog: | DF15348 |
| Description: | Rabbit polyclonal antibody to DUSP23 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 17kD(Calculated). |
| Uniprot: | Q9BVJ7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Dual specificity phosphatase 23; Dual specificity protein phosphatase 23; DUS23_HUMAN; Dusp23; DUSP25; EC 3.1.3.16; EC 3.1.3.48; FLJ20442; LDP 3; LDP-3; LDP3; Low molecular mass dual specificity phosphatase 3; MOSP; RP11-190A12.1; VH1 like member Z; VH1 like phosphatase Z; VH1-like phosphatase Z; VHZ;
Immunogens
A synthesized peptide derived from human DUSP23.
Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
- Q9BVJ7 DUS23_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Research Backgrounds
Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).
Cytoplasm>Cytosol. Nucleus.
Note: Mainly cytosolic. Also nuclear.
Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.