Product: KLF3 Antibody
Catalog: DF15349
Description: Rabbit polyclonal antibody to KLF3
Application: WB IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 39kD(Calculated).
Uniprot: P57682

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
KLF3 Antibody detects endogenous levels of KLF3.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Basic krueppel-like factor; Basic Kruppel like factor; BKLF3; CACCC box binding protein BKLF; CACCC-box-binding protein BKLF; Klf3; KLF3_HUMAN; Krueppel-like factor 3; Kruppel like factor 3 (basic); MGC48279; TEF-2; TEF2; Transcript ch138; Zinc finger protein 741; ZNF741;

Immunogens

Immunogen:

A synthesized peptide derived from human KLF3.

Uniprot:
Gene(ID):
Sequence:
MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV

Research Backgrounds

Function:

Binds to the CACCC box of erythroid cell-expressed genes. May play a role in hematopoiesis (By similarity).

PTMs:

Sumoylated with SUMO1. Sumoylation is enhanced by PIAS1, PIAS2alpha and PIAS2beta, and PIAS4, but not by Pc2. Enhances transcriptional repression, but has no effect on DNA binding. Sumoylation on Lys-198 is the major site (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. In KLF3, the motif is inactive.

Belongs to the krueppel C2H2-type zinc-finger protein family.

Research Fields

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

References

1). KLF3 aggravates renal fibrosis in chronic kidney disease through transcriptional activation of DDAH2. Biochemical pharmacology, 2025 (PubMed: 40480524) [IF=5.3]

2). KLF3 transcription activates WNT1 and promotes the growth and metastasis of gastric cancer via activation of the WNT/β-catenin signaling pathway. LABORATORY INVESTIGATION, 2023 (PubMed: 36827869) [IF=5.1]

3). ZFP36 regulates the osteogenic differentiation of adipose-derived mesenchymal stem cells in osteoporosis by mediating KLF3 mRNA degradation. Scientific reports, 2025 (PubMed: 40274995) [IF=3.8]

Application: IHC    Species: Rat    Sample:

Fig. 2 KLF3 over-expression inhibited osteogenic differentiation. (A) Detection of KLF3 mRNA expression by RT-qPCR. (B) Detection of KLF3 protein expression by Western Blot. (C) Representative images of ALP activity between different groups, Scale bars: 200 μm. (D) Representative images of Alizarin Red S staining between different groups, Scale bars: 200 μm. (E) Representative DAPI and OCN images of osteogenic by Immunofluorescence. Scale bars: 100 μm. (F) Representative DAPI and RUNX2 images of osteogenic by Immunofluorescence, Scale bars: 100 μm. *P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.