KLF3 Antibody - #DF15349

Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Basic krueppel-like factor; Basic Kruppel like factor; BKLF3; CACCC box binding protein BKLF; CACCC-box-binding protein BKLF; Klf3; KLF3_HUMAN; Krueppel-like factor 3; Kruppel like factor 3 (basic); MGC48279; TEF-2; TEF2; Transcript ch138; Zinc finger protein 741; ZNF741;
Immunogens
A synthesized peptide derived from human KLF3.
- P57682 KLF3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Research Backgrounds
Binds to the CACCC box of erythroid cell-expressed genes. May play a role in hematopoiesis (By similarity).
Sumoylated with SUMO1. Sumoylation is enhanced by PIAS1, PIAS2alpha and PIAS2beta, and PIAS4, but not by Pc2. Enhances transcriptional repression, but has no effect on DNA binding. Sumoylation on Lys-198 is the major site (By similarity).
Nucleus.
Monomer.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors. In KLF3, the motif is inactive.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.