ARL4D Antibody - #DF15384
| Product: | ARL4D Antibody |
| Catalog: | DF15384 |
| Description: | Rabbit polyclonal antibody to ARL4D |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 22kD(Calculated). |
| Uniprot: | P49703 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
ADP ribosylation factor 4 like; ADP ribosylation factor like 4D; ADP ribosylation factor like 6; ADP ribosylation factor like protein 4D; ADP ribosylation factor like protein 4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like protein 4L; AR L6; ARF 4L; ARF4L; ARL 4D; ARL 6; ARL4D; ARL4D_HUMAN; ARL6;
Immunogens
A synthesized peptide derived from human ARL4D.
- P49703 ARL4D_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
Research Backgrounds
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.
Nucleus>Nucleolus. Cell membrane. Nucleus. Cytoplasm.
Belongs to the small GTPase superfamily. Arf family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.