TSPY1 Antibody - #DF15420
| Product: | TSPY1 Antibody |
| Catalog: | DF15420 |
| Description: | Rabbit polyclonal antibody to TSPY1 |
| Application: | WB ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 35kD(Calculated). |
| Uniprot: | Q01534 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cancer/testis antigen 78; CT78; DYS14; pJA 923; pJA923; Testis specific protein Y linked 1; Testis specific Y encoded protein 1; Testis-specific Y-encoded protein 1; TSPY 1; TSPY; Tspy1; TSPY1_HUMAN;
Immunogens
A synthesized peptide derived from human TSPY1.
Specifically expressed in testicular tissues. Isoform 1 and isoform 2 are expressed in spermatogonia and spermatocytes. Found in early testicular carcinoma in situ, spermatogonial cells in testicular tissues of 46,X,Y female and in prostate cancer cell lines.
- Q01534 TSPY1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
Research Backgrounds
May be involved in sperm differentiation and proliferation.
Phosphorylated.
Cytoplasm. Nucleus.
Note: Predominantly cytoplasmic. Also found in nucleus.
Specifically expressed in testicular tissues. Isoform 1 and isoform 2 are expressed in spermatogonia and spermatocytes. Found in early testicular carcinoma in situ, spermatogonial cells in testicular tissues of 46,X,Y female and in prostate cancer cell lines.
Belongs to the nucleosome assembly protein (NAP) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.